PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 511aa    MW: 56637.9 Da    PI: 8.2397
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0754genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46e-1759105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
      Gh_A13G0754  59 KGGWTPEEDETLRNAVAAFKGKSWKKIAEFFP-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding57.62.9e-18111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ed++++++v ++G+  W+ Ia+ ++ gR +kqc++rw+++l
      Gh_A13G0754 111 KGPWTQKEDDKIIELVSKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 157
                      79******************************.*************97 PP

3Myb_DNA-binding52.41.2e-16163206146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
      Gh_A13G0754 163 KDAWTMEEELALMNAHRTYGNK-WAEIAKVLP-GRTDNAIKNHWNS 206
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.81954105IPR017930Myb domain
SMARTSM007171.2E-1458107IPR001005SANT/Myb domain
PfamPF002491.4E-1559105IPR001005SANT/Myb domain
SuperFamilySSF466896.75E-1760122IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-2261117IPR009057Homeodomain-like
CDDcd001671.20E-1262105No hitNo description
PROSITE profilePS5129431.635106161IPR017930Myb domain
SuperFamilySSF466891.5E-31108204IPR009057Homeodomain-like
SMARTSM007172.4E-17110159IPR001005SANT/Myb domain
PfamPF002498.6E-18111157IPR001005SANT/Myb domain
CDDcd001676.34E-15113157No hitNo description
Gene3DG3DSA:1.10.10.605.2E-27118164IPR009057Homeodomain-like
SMARTSM007172.9E-15162210IPR001005SANT/Myb domain
PROSITE profilePS5129421.801162212IPR017930Myb domain
PfamPF002494.2E-15163206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-23165212IPR009057Homeodomain-like
CDDcd001672.13E-11165208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MAELRLEERC LYKKQLTTAS SSSVSEGGGN AVVKSPGVSS PAPTSPNHRR TTGPIRRAKG  60
GWTPEEDETL RNAVAAFKGK SWKKIAEFFP DRSEVQCLHR WQKVLNPDLV KGPWTQKEDD  120
KIIELVSKYG PTKWSVIAKS LPGRIGKQCR ERWHNHLNPD IKKDAWTMEE ELALMNAHRT  180
YGNKWAEIAK VLPGRTDNAI KNHWNSSLKK KLDFYLATGK LPPVSKNGLQ NVTKDIRTPT  240
NQNFLVCLKK ESGSTAQTSS GTTDTCKLEE DGKDQLESSA PVQDMTASTN FIPEEPTDTE  300
STECKLQSVD INLCCCTSES GGKFGSHRIS SQVVEDKVLK EQVGLDTPTY CSLCCDESPR  360
SQHEWTSTPI TSPISFFTPP CVKGSGLSIH SPEYILRIAA KSFLNTPSIF RKRKMGAQVL  420
TLPNKKGKLN EEIGKDGIQL SGEQERTENS SEQAQFCDGD PCESPACQGD SPTLPNSTVF  480
NVSPPHRLRS NRTAVLKSVE RQLELTFDKE A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-70582125159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-70582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012442444.10.0PREDICTED: myb-related protein A-like
RefseqXP_012442451.10.0PREDICTED: myb-related protein A-like
TrEMBLA0A0B0NHP10.0A0A0B0NHP1_G
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-150myb domain protein 3r-5